Anti F2 pAb (ATL-HPA054698 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054698-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using Anti-F2 antibody. Corresponding F2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: coagulation factor II (thrombin)
Gene Name: F2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027249: 68%, ENSRNOG00000016325: 65%
Entrez Gene ID: 2147
Uniprot ID: P00734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE
Gene Sequence EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE
Gene ID - Mouse ENSMUSG00000027249
Gene ID - Rat ENSRNOG00000016325
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti F2 pAb (ATL-HPA054698 w/enhanced validation)
Datasheet Anti F2 pAb (ATL-HPA054698 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti F2 pAb (ATL-HPA054698 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti F2 pAb (ATL-HPA054698 w/enhanced validation)
Datasheet Anti F2 pAb (ATL-HPA054698 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti F2 pAb (ATL-HPA054698 w/enhanced validation)