Anti F13B pAb (ATL-HPA052139)

Atlas Antibodies

SKU:
ATL-HPA052139-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coagulation factor XIII, B polypeptide
Gene Name: F13B
Alternative Gene Name: FXIIIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026368: 76%, ENSRNOG00000012613: 74%
Entrez Gene ID: 2165
Uniprot ID: P05160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEY
Gene Sequence EMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEY
Gene ID - Mouse ENSMUSG00000026368
Gene ID - Rat ENSRNOG00000012613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti F13B pAb (ATL-HPA052139)
Datasheet Anti F13B pAb (ATL-HPA052139) Datasheet (External Link)
Vendor Page Anti F13B pAb (ATL-HPA052139) at Atlas Antibodies

Documents & Links for Anti F13B pAb (ATL-HPA052139)
Datasheet Anti F13B pAb (ATL-HPA052139) Datasheet (External Link)
Vendor Page Anti F13B pAb (ATL-HPA052139)