Protein Description: enhancer of zeste 1 polycomb repressive complex 2 subunit
Gene Name: EZH1
Alternative Gene Name: KIAA0388, KMT6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006920: 96%, ENSRNOG00000020336: 92%
Entrez Gene ID: 2145
Uniprot ID: Q92800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EZH1
Alternative Gene Name: KIAA0388, KMT6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006920: 96%, ENSRNOG00000020336: 92%
Entrez Gene ID: 2145
Uniprot ID: Q92800
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE |
| Documents & Links for Anti EZH1 pAb (ATL-HPA077684) | |
| Datasheet | Anti EZH1 pAb (ATL-HPA077684) Datasheet (External Link) |
| Vendor Page | Anti EZH1 pAb (ATL-HPA077684) at Atlas |
| Documents & Links for Anti EZH1 pAb (ATL-HPA077684) | |
| Datasheet | Anti EZH1 pAb (ATL-HPA077684) Datasheet (External Link) |
| Vendor Page | Anti EZH1 pAb (ATL-HPA077684) |