Protein Description: EYA transcriptional coactivator and phosphatase 3
Gene Name: EYA3
Alternative Gene Name: DKFZp686C132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028886: 88%, ENSRNOG00000010396: 82%
Entrez Gene ID: 2140
Uniprot ID: Q99504
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EYA3
Alternative Gene Name: DKFZp686C132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028886: 88%, ENSRNOG00000010396: 82%
Entrez Gene ID: 2140
Uniprot ID: Q99504
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSG |
Documents & Links for Anti EYA3 pAb (ATL-HPA062889) | |
Datasheet | Anti EYA3 pAb (ATL-HPA062889) Datasheet (External Link) |
Vendor Page | Anti EYA3 pAb (ATL-HPA062889) at Atlas |
Documents & Links for Anti EYA3 pAb (ATL-HPA062889) | |
Datasheet | Anti EYA3 pAb (ATL-HPA062889) Datasheet (External Link) |
Vendor Page | Anti EYA3 pAb (ATL-HPA062889) |