Anti EYA3 pAb (ATL-HPA052432)

Atlas Antibodies

SKU:
ATL-HPA052432-25
  • Immunohistochemical staining of human colon shows strong membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EYA transcriptional coactivator and phosphatase 3
Gene Name: EYA3
Alternative Gene Name: DKFZp686C132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028886: 97%, ENSRNOG00000010396: 98%
Entrez Gene ID: 2140
Uniprot ID: Q99504
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI
Gene Sequence YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI
Gene ID - Mouse ENSMUSG00000028886
Gene ID - Rat ENSRNOG00000010396
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EYA3 pAb (ATL-HPA052432)
Datasheet Anti EYA3 pAb (ATL-HPA052432) Datasheet (External Link)
Vendor Page Anti EYA3 pAb (ATL-HPA052432) at Atlas Antibodies

Documents & Links for Anti EYA3 pAb (ATL-HPA052432)
Datasheet Anti EYA3 pAb (ATL-HPA052432) Datasheet (External Link)
Vendor Page Anti EYA3 pAb (ATL-HPA052432)