Anti EYA3 pAb (ATL-HPA052432)
Atlas Antibodies
- SKU:
- ATL-HPA052432-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EYA3
Alternative Gene Name: DKFZp686C132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028886: 97%, ENSRNOG00000010396: 98%
Entrez Gene ID: 2140
Uniprot ID: Q99504
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI |
Gene Sequence | YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI |
Gene ID - Mouse | ENSMUSG00000028886 |
Gene ID - Rat | ENSRNOG00000010396 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EYA3 pAb (ATL-HPA052432) | |
Datasheet | Anti EYA3 pAb (ATL-HPA052432) Datasheet (External Link) |
Vendor Page | Anti EYA3 pAb (ATL-HPA052432) at Atlas Antibodies |
Documents & Links for Anti EYA3 pAb (ATL-HPA052432) | |
Datasheet | Anti EYA3 pAb (ATL-HPA052432) Datasheet (External Link) |
Vendor Page | Anti EYA3 pAb (ATL-HPA052432) |