Anti EYA2 pAb (ATL-HPA027024)

Atlas Antibodies

SKU:
ATL-HPA027024-25
  • Immunohistochemical staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.
  • Western blot analysis in human cell line SCLC-21H.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: EYA transcriptional coactivator and phosphatase 2
Gene Name: EYA2
Alternative Gene Name: EAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017897: 86%, ENSRNOG00000019203: 88%
Entrez Gene ID: 2139
Uniprot ID: O00167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD
Gene Sequence GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD
Gene ID - Mouse ENSMUSG00000017897
Gene ID - Rat ENSRNOG00000019203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EYA2 pAb (ATL-HPA027024)
Datasheet Anti EYA2 pAb (ATL-HPA027024) Datasheet (External Link)
Vendor Page Anti EYA2 pAb (ATL-HPA027024) at Atlas Antibodies

Documents & Links for Anti EYA2 pAb (ATL-HPA027024)
Datasheet Anti EYA2 pAb (ATL-HPA027024) Datasheet (External Link)
Vendor Page Anti EYA2 pAb (ATL-HPA027024)



Citations for Anti EYA2 pAb (ATL-HPA027024) – 5 Found
Farabaugh, S M; Micalizzi, D S; Jedlicka, P; Zhao, R; Ford, H L. Eya2 is required to mediate the pro-metastatic functions of Six1 via the induction of TGF-β signaling, epithelial-mesenchymal transition, and cancer stem cell properties. Oncogene. 2012;31(5):552-62.  PubMed
Yuan, Bin; Cheng, Long; Chiang, Huai-Chin; Xu, Xiaojie; Han, Yongjian; Su, Hang; Wang, Lingxue; Zhang, Bo; Lin, Jing; Li, Xiaobing; Xie, Xiangyang; Wang, Tao; Tekmal, Rajeshwar R; Curiel, Tyler J; Yuan, Zhi-Min; Elledge, Richard; Hu, Yanfen; Ye, Qinong; Li, Rong. A phosphotyrosine switch determines the antitumor activity of ERβ. The Journal Of Clinical Investigation. 2014;124(8):3378-90.  PubMed
Zheng, Jie; Cao, Fuao; Huang, Xiaopei; Ramen, Kuvaneshan; Xu, Xiaowen; Zhu, Yan; Chang, Wenjun; Shan, Yunfeng; Guo, Aizhen. Eyes absent homologue 2 predicts a favorable prognosis in colorectal cancer. Oncotargets And Therapy. 11( 30122957):4661-4671.  PubMed
Anantharajan, Jothi; Zhou, Hengbo; Zhang, Lingdi; Hotz, Taylor; Vincent, Melanie Y; Blevins, Melanie A; Jansson, Anna E; Kuan, John Wee Liang; Ng, Elizabeth Yihui; Yeo, Yee Khoon; Baburajendran, Nithya; Lin, Grace; Hung, Alvin W; Joy, Joma; Patnaik, Samarjit; Marugan, Juan; Rudra, Pratyaydipta; Ghosh, Debashis; Hill, Jeffrey; Keller, Thomas H; Zhao, Rui; Ford, Heide L; Kang, CongBao. Structural and Functional Analyses of an Allosteric EYA2 Phosphatase Inhibitor That Has On-Target Effects in Human Lung Cancer Cells. Molecular Cancer Therapeutics. 2019;18(9):1484-1496.  PubMed
Zhou, Hengbo; Blevins, Melanie A; Hsu, Jessica Y; Kong, Deguang; Galbraith, Matthew D; Goodspeed, Andrew; Culp-Hill, Rachel; Oliphant, Michael U J; Ramirez, Dominique; Zhang, Lingdi; Trinidad-Pineiro, Jennyvette; Mathews Griner, Lesley; King, Rebecca; Barnaeva, Elena; Hu, Xin; Southall, Noel T; Ferrer, Marc; Gustafson, Daniel L; Regan, Daniel P; D'Alessandro, Angelo; Costello, James C; Patnaik, Samarjit; Marugan, Juan; Zhao, Rui; Ford, Heide L. Identification of a Small-Molecule Inhibitor That Disrupts the SIX1/EYA2 Complex, EMT, and Metastasis. Cancer Research. 2020;80(12):2689-2702.  PubMed