Anti EXOSC5 pAb (ATL-HPA055677)

Atlas Antibodies

SKU:
ATL-HPA055677-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exosome component 5
Gene Name: EXOSC5
Alternative Gene Name: hRrp46p, MGC12901, p12B, RRP41B, RRP46, Rrp46p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061286: 80%, ENSRNOG00000020635: 81%
Entrez Gene ID: 56915
Uniprot ID: Q9NQT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI
Gene Sequence MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI
Gene ID - Mouse ENSMUSG00000061286
Gene ID - Rat ENSRNOG00000020635
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOSC5 pAb (ATL-HPA055677)
Datasheet Anti EXOSC5 pAb (ATL-HPA055677) Datasheet (External Link)
Vendor Page Anti EXOSC5 pAb (ATL-HPA055677) at Atlas Antibodies

Documents & Links for Anti EXOSC5 pAb (ATL-HPA055677)
Datasheet Anti EXOSC5 pAb (ATL-HPA055677) Datasheet (External Link)
Vendor Page Anti EXOSC5 pAb (ATL-HPA055677)