Anti EXOSC10 pAb (ATL-HPA028470 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028470-100

• 
• 

Protein Description: exosome component 10
Gene Name: EXOSC10
Alternative Gene Name: p2, p3, p4, PM-Scl, PM/Scl-100, PMSCL2, RRP6, Rrp6p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017264: 93%, ENSRNOG00000010719: 93%
Entrez Gene ID: 5394
Uniprot ID: Q01780
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA
• Gene Sequence: KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA
• Gene ID - Mouse: ENSMUSG00000017264
• Gene ID - Rat: ENSRNOG00000010719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EXOSC10 pAb (ATL-HPA028470 w/enhanced validation) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.