Anti EXOG pAb (ATL-HPA071050)

Atlas Antibodies

SKU:
ATL-HPA071050-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: exo/endonuclease G
Gene Name: EXOG
Alternative Gene Name: ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042787: 77%, ENSRNOG00000014801: 72%
Entrez Gene ID: 9941
Uniprot ID: Q9Y2C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHI
Gene Sequence AALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHI
Gene ID - Mouse ENSMUSG00000042787
Gene ID - Rat ENSRNOG00000014801
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EXOG pAb (ATL-HPA071050)
Datasheet Anti EXOG pAb (ATL-HPA071050) Datasheet (External Link)
Vendor Page Anti EXOG pAb (ATL-HPA071050) at Atlas Antibodies

Documents & Links for Anti EXOG pAb (ATL-HPA071050)
Datasheet Anti EXOG pAb (ATL-HPA071050) Datasheet (External Link)
Vendor Page Anti EXOG pAb (ATL-HPA071050)