Protein Description: exo/endonuclease G
Gene Name: EXOG
Alternative Gene Name: ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042787: 77%, ENSRNOG00000014801: 72%
Entrez Gene ID: 9941
Uniprot ID: Q9Y2C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EXOG
Alternative Gene Name: ENDOGL1, ENDOGL2, ENGL, ENGL-a, ENGL-b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042787: 77%, ENSRNOG00000014801: 72%
Entrez Gene ID: 9941
Uniprot ID: Q9Y2C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AALQFFRSQGAEGALTGKQPDGSAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHI |
| Documents & Links for Anti EXOG pAb (ATL-HPA071050) | |
| Datasheet | Anti EXOG pAb (ATL-HPA071050) Datasheet (External Link) |
| Vendor Page | Anti EXOG pAb (ATL-HPA071050) at Atlas |
| Documents & Links for Anti EXOG pAb (ATL-HPA071050) | |
| Datasheet | Anti EXOG pAb (ATL-HPA071050) Datasheet (External Link) |
| Vendor Page | Anti EXOG pAb (ATL-HPA071050) |