Anti EXD3 pAb (ATL-HPA047395)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047395-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: EXD3
Alternative Gene Name: FLJ20433, LOC54932, mut-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023047: 24%, ENSRNOG00000018804: 24%
Entrez Gene ID: 54932
Uniprot ID: Q8N9H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FAALDDPLAGLLDMLESCRGQRGEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARVVKVLTESPPSLAAPLASIFQLQDADRSCLLAHVHR |
Gene Sequence | FAALDDPLAGLLDMLESCRGQRGEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARVVKVLTESPPSLAAPLASIFQLQDADRSCLLAHVHR |
Gene ID - Mouse | ENSMUSG00000023047 |
Gene ID - Rat | ENSRNOG00000018804 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EXD3 pAb (ATL-HPA047395) | |
Datasheet | Anti EXD3 pAb (ATL-HPA047395) Datasheet (External Link) |
Vendor Page | Anti EXD3 pAb (ATL-HPA047395) at Atlas Antibodies |
Documents & Links for Anti EXD3 pAb (ATL-HPA047395) | |
Datasheet | Anti EXD3 pAb (ATL-HPA047395) Datasheet (External Link) |
Vendor Page | Anti EXD3 pAb (ATL-HPA047395) |