Anti EWSR1 pAb (ATL-HPA051771 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051771-100
  • Immunohistochemical staining of human gastrointestinal, kidney, squamous epithelia and testis using Anti-EWSR1 antibody HPA051771 (A) shows similar protein distribution across tissues to independent antibody HPA062953 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line Daudi.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: EWS RNA-binding protein 1
Gene Name: EWSR1
Alternative Gene Name: EWS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009079: 98%, ENSRNOG00000046950: 98%
Entrez Gene ID: 2130
Uniprot ID: Q01844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGG
Gene Sequence GQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGG
Gene ID - Mouse ENSMUSG00000009079
Gene ID - Rat ENSRNOG00000046950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EWSR1 pAb (ATL-HPA051771 w/enhanced validation)
Datasheet Anti EWSR1 pAb (ATL-HPA051771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EWSR1 pAb (ATL-HPA051771 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EWSR1 pAb (ATL-HPA051771 w/enhanced validation)
Datasheet Anti EWSR1 pAb (ATL-HPA051771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EWSR1 pAb (ATL-HPA051771 w/enhanced validation)