Anti EVI5 pAb (ATL-HPA053724)

Atlas Antibodies

SKU:
ATL-HPA053724-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ecotropic viral integration site 5
Gene Name: EVI5
Alternative Gene Name: NB4S
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011831: 71%, ENSRNOG00000002039: 72%
Entrez Gene ID: 7813
Uniprot ID: O60447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPPFDGIHIVNHLIGDDESFHSSDEDFIDNSLQETGVGFPLHGKSGSMSLDPAVADGSESETEDSVLETRESNQVVQKERPPRRRESYSTTV
Gene Sequence QPPFDGIHIVNHLIGDDESFHSSDEDFIDNSLQETGVGFPLHGKSGSMSLDPAVADGSESETEDSVLETRESNQVVQKERPPRRRESYSTTV
Gene ID - Mouse ENSMUSG00000011831
Gene ID - Rat ENSRNOG00000002039
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EVI5 pAb (ATL-HPA053724)
Datasheet Anti EVI5 pAb (ATL-HPA053724) Datasheet (External Link)
Vendor Page Anti EVI5 pAb (ATL-HPA053724) at Atlas Antibodies

Documents & Links for Anti EVI5 pAb (ATL-HPA053724)
Datasheet Anti EVI5 pAb (ATL-HPA053724) Datasheet (External Link)
Vendor Page Anti EVI5 pAb (ATL-HPA053724)