Protein Description: ets variant 1
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 100%, ENSRNOG00000006867: 98%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 100%, ENSRNOG00000006867: 98%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPE |
| Documents & Links for Anti ETV1 pAb (ATL-HPA077249) | |
| Datasheet | Anti ETV1 pAb (ATL-HPA077249) Datasheet (External Link) |
| Vendor Page | Anti ETV1 pAb (ATL-HPA077249) at Atlas |
| Documents & Links for Anti ETV1 pAb (ATL-HPA077249) | |
| Datasheet | Anti ETV1 pAb (ATL-HPA077249) Datasheet (External Link) |
| Vendor Page | Anti ETV1 pAb (ATL-HPA077249) |