Anti ESX1 pAb (ATL-HPA051992 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051992-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ESX1 antibody. Corresponding ESX1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ESX homeobox 1
Gene Name: ESX1
Alternative Gene Name: ESX1L, ESXR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028383: 37%, ENSRNOG00000016692: 36%
Entrez Gene ID: 80712
Uniprot ID: Q8N693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HEPEQQQEEPPLLELKQEQEEPPQTTVEGPQPAEGPQTAEGPQPPERKRRRRTAFTQFQ
Gene Sequence HEPEQQQEEPPLLELKQEQEEPPQTTVEGPQPAEGPQTAEGPQPPERKRRRRTAFTQFQ
Gene ID - Mouse ENSMUSG00000028383
Gene ID - Rat ENSRNOG00000016692
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ESX1 pAb (ATL-HPA051992 w/enhanced validation)
Datasheet Anti ESX1 pAb (ATL-HPA051992 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ESX1 pAb (ATL-HPA051992 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ESX1 pAb (ATL-HPA051992 w/enhanced validation)
Datasheet Anti ESX1 pAb (ATL-HPA051992 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ESX1 pAb (ATL-HPA051992 w/enhanced validation)