Anti ESRRA pAb (ATL-HPA053785)

Atlas Antibodies

SKU:
ATL-HPA053785-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, nucleoli fibrillar center, microtubules & cytokinetic bridge.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: estrogen-related receptor alpha
Gene Name: ESRRA
Alternative Gene Name: ERR1, ERRa, ERRalpha, ESRL1, NR3B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024955: 94%, ENSRNOG00000021139: 94%
Entrez Gene ID: 2101
Uniprot ID: P11474
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDG
Gene Sequence SQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDG
Gene ID - Mouse ENSMUSG00000024955
Gene ID - Rat ENSRNOG00000021139
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ESRRA pAb (ATL-HPA053785)
Datasheet Anti ESRRA pAb (ATL-HPA053785) Datasheet (External Link)
Vendor Page Anti ESRRA pAb (ATL-HPA053785) at Atlas Antibodies

Documents & Links for Anti ESRRA pAb (ATL-HPA053785)
Datasheet Anti ESRRA pAb (ATL-HPA053785) Datasheet (External Link)
Vendor Page Anti ESRRA pAb (ATL-HPA053785)



Citations for Anti ESRRA pAb (ATL-HPA053785) – 1 Found
Dings, Mark P G; van der Zalm, Amber P; Bootsma, Sanne; van Maanen, Tatum F J; Waasdorp, Cynthia; van den Ende, Tom; Liu, Dajia; Bailey, Peter; Koster, Jan; Zwijnenburg, Danny A; Spek, C Arnold; Klomp, Jan P G; Oubrie, Arthur; Hooijer, Gerrit K J; Meijer, Sybren L; van Berge Henegouwen, Mark I; Hulshof, Maarten C; Bergman, Jacques; Oyarce, Cesar; Medema, Jan Paul; van Laarhoven, Hanneke W M; Bijlsma, Maarten F. Estrogen-related receptor alpha drives mitochondrial biogenesis and resistance to neoadjuvant chemoradiation in esophageal cancer. Cell Reports. Medicine. 2022;3(11):100802.  PubMed