Anti ESRP2 pAb (ATL-HPA048618)

Atlas Antibodies

SKU: ATL-HPA048618-25

• 
• 

Protein Description: epithelial splicing regulatory protein 2
Gene Name: ESRP2
Alternative Gene Name: FLJ21918, RBM35B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084128: 89%, ENSRNOG00000023177: 87%
Entrez Gene ID: 80004
Uniprot ID: Q9H6T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL
• Gene Sequence: TTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL
• Gene ID - Mouse: ENSMUSG00000084128
• Gene ID - Rat: ENSRNOG00000023177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.