Anti ESRP2 pAb (ATL-HPA048618)
Atlas Antibodies
- SKU:
- ATL-HPA048618-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ESRP2
Alternative Gene Name: FLJ21918, RBM35B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084128: 89%, ENSRNOG00000023177: 87%
Entrez Gene ID: 80004
Uniprot ID: Q9H6T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL |
Gene Sequence | TTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL |
Gene ID - Mouse | ENSMUSG00000084128 |
Gene ID - Rat | ENSRNOG00000023177 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ESRP2 pAb (ATL-HPA048618) | |
Datasheet | Anti ESRP2 pAb (ATL-HPA048618) Datasheet (External Link) |
Vendor Page | Anti ESRP2 pAb (ATL-HPA048618) at Atlas Antibodies |
Documents & Links for Anti ESRP2 pAb (ATL-HPA048618) | |
Datasheet | Anti ESRP2 pAb (ATL-HPA048618) Datasheet (External Link) |
Vendor Page | Anti ESRP2 pAb (ATL-HPA048618) |