Protein Description: extra spindle pole bodies like 1, separase
Gene Name: ESPL1
Alternative Gene Name: ESP1, KIAA0165, SEPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058290: 84%, ENSRNOG00000012835: 85%
Entrez Gene ID: 9700
Uniprot ID: Q14674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ESPL1
Alternative Gene Name: ESP1, KIAA0165, SEPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058290: 84%, ENSRNOG00000012835: 85%
Entrez Gene ID: 9700
Uniprot ID: Q14674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTKLQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQKGKQQAQVPCPPQLPEEELFLRGPALELVA |
| Documents & Links for Anti ESPL1 pAb (ATL-HPA073188) | |
| Datasheet | Anti ESPL1 pAb (ATL-HPA073188) Datasheet (External Link) |
| Vendor Page | Anti ESPL1 pAb (ATL-HPA073188) at Atlas |
| Documents & Links for Anti ESPL1 pAb (ATL-HPA073188) | |
| Datasheet | Anti ESPL1 pAb (ATL-HPA073188) Datasheet (External Link) |
| Vendor Page | Anti ESPL1 pAb (ATL-HPA073188) |