Anti ESF1 pAb (ATL-HPA047083)

Atlas Antibodies

SKU: ATL-HPA047083-25

• 

Protein Description: ESF1, nucleolar pre-rRNA processing protein, homolog (S. cerevisiae)
Gene Name: ESF1
Alternative Gene Name: bA526K24.1, C20orf6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045624: 94%, ENSRNOG00000004777: 94%
Entrez Gene ID: 51575
Uniprot ID: Q9H501
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEMALLMMDEDEDSKKHFNYNKIVEHQNLSKKKKKQLMKKKELIEDDFEVNVNDARFQAMYTSHLFNLDPSDPNFKKTKAME
• Gene Sequence: AEMALLMMDEDEDSKKHFNYNKIVEHQNLSKKKKKQLMKKKELIEDDFEVNVNDARFQAMYTSHLFNLDPSDPNFKKTKAME
• Gene ID - Mouse: ENSMUSG00000045624
• Gene ID - Rat: ENSRNOG00000004777
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.