Protein Description: establishment of sister chromatid cohesion N-acetyltransferase 2
Gene Name: ESCO2
Alternative Gene Name: EFO2, RBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022034: 48%, ENSRNOG00000015921: 53%
Entrez Gene ID: 157570
Uniprot ID: Q56NI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ESCO2
Alternative Gene Name: EFO2, RBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022034: 48%, ENSRNOG00000015921: 53%
Entrez Gene ID: 157570
Uniprot ID: Q56NI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSF |
| Gene ID - Mouse | ENSMUSG00000022034 |
| Gene ID - Rat | ENSMUSG00000022034 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ESCO2 pAb (ATL-HPA053679) | |
| Datasheet | Anti ESCO2 pAb (ATL-HPA053679) Datasheet (External Link) |
| Vendor Page | Anti ESCO2 pAb (ATL-HPA053679) at Atlas |
| Documents & Links for Anti ESCO2 pAb (ATL-HPA053679) | |
| Datasheet | Anti ESCO2 pAb (ATL-HPA053679) Datasheet (External Link) |
| Vendor Page | Anti ESCO2 pAb (ATL-HPA053679) |