Anti ESAM pAb (ATL-HPA051043)
Atlas Antibodies
- SKU:
- ATL-HPA051043-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ESAM
Alternative Gene Name: W117m
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001946: 72%, ENSRNOG00000033217: 72%
Entrez Gene ID: 90952
Uniprot ID: Q96AP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL |
Gene Sequence | DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL |
Gene ID - Mouse | ENSMUSG00000001946 |
Gene ID - Rat | ENSRNOG00000033217 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ESAM pAb (ATL-HPA051043) | |
Datasheet | Anti ESAM pAb (ATL-HPA051043) Datasheet (External Link) |
Vendor Page | Anti ESAM pAb (ATL-HPA051043) at Atlas Antibodies |
Documents & Links for Anti ESAM pAb (ATL-HPA051043) | |
Datasheet | Anti ESAM pAb (ATL-HPA051043) Datasheet (External Link) |
Vendor Page | Anti ESAM pAb (ATL-HPA051043) |