Protein Description: ERBB receptor feedback inhibitor 1
Gene Name: ERRFI1
Alternative Gene Name: GENE-33, MIG-6, RALT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028967: 70%, ENSRNOG00000058186: 74%
Entrez Gene ID: 54206
Uniprot ID: Q9UJM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERRFI1
Alternative Gene Name: GENE-33, MIG-6, RALT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028967: 70%, ENSRNOG00000058186: 74%
Entrez Gene ID: 54206
Uniprot ID: Q9UJM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHASKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCA |
| Documents & Links for Anti ERRFI1 pAb (ATL-HPA076543) | |
| Datasheet | Anti ERRFI1 pAb (ATL-HPA076543) Datasheet (External Link) |
| Vendor Page | Anti ERRFI1 pAb (ATL-HPA076543) at Atlas |
| Documents & Links for Anti ERRFI1 pAb (ATL-HPA076543) | |
| Datasheet | Anti ERRFI1 pAb (ATL-HPA076543) Datasheet (External Link) |
| Vendor Page | Anti ERRFI1 pAb (ATL-HPA076543) |