Anti ERRFI1 pAb (ATL-HPA076543)

Catalog No:
ATL-HPA076543-25
$447.00
Protein Description: ERBB receptor feedback inhibitor 1
Gene Name: ERRFI1
Alternative Gene Name: GENE-33, MIG-6, RALT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028967: 70%, ENSRNOG00000058186: 74%
Entrez Gene ID: 54206
Uniprot ID: Q9UJM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSAQERLIPLGHASKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTVNGVCA
Gene ID - Mouse ENSMUSG00000028967
Gene ID - Rat ENSMUSG00000028967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ERRFI1 pAb (ATL-HPA076543)
Datasheet Anti ERRFI1 pAb (ATL-HPA076543) Datasheet (External Link)
Vendor Page Anti ERRFI1 pAb (ATL-HPA076543) at Atlas

Documents & Links for Anti ERRFI1 pAb (ATL-HPA076543)
Datasheet Anti ERRFI1 pAb (ATL-HPA076543) Datasheet (External Link)
Vendor Page Anti ERRFI1 pAb (ATL-HPA076543)