Anti ERP27 pAb (ATL-HPA052851 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052851-25

• 
• 

Protein Description: endoplasmic reticulum protein 27
Gene Name: ERP27
Alternative Gene Name: C12orf46, ERp27, FLJ32115, PDIA8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030219: 64%, ENSRNOG00000005787: 66%
Entrez Gene ID: 121506
Uniprot ID: Q96DN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQ
• Gene Sequence: FQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQ
• Gene ID - Mouse: ENSMUSG00000030219
• Gene ID - Rat: ENSRNOG00000005787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.