Anti ERMAP pAb (ATL-HPA054672)

Atlas Antibodies

SKU:
ATL-HPA054672-25
  • Immunofluorescent staining of human cell line HEL shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: erythroblast membrane associated protein (Scianna blood group)
Gene Name: ERMAP
Alternative Gene Name: BTN5, RD, SC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028644: 83%, ENSRNOG00000000335: 81%
Entrez Gene ID: 114625
Uniprot ID: Q96PL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD
Gene Sequence IWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPD
Gene ID - Mouse ENSMUSG00000028644
Gene ID - Rat ENSRNOG00000000335
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERMAP pAb (ATL-HPA054672)
Datasheet Anti ERMAP pAb (ATL-HPA054672) Datasheet (External Link)
Vendor Page Anti ERMAP pAb (ATL-HPA054672) at Atlas Antibodies

Documents & Links for Anti ERMAP pAb (ATL-HPA054672)
Datasheet Anti ERMAP pAb (ATL-HPA054672) Datasheet (External Link)
Vendor Page Anti ERMAP pAb (ATL-HPA054672)