Anti ERI1 pAb (ATL-HPA055548)
Atlas Antibodies
- SKU:
- ATL-HPA055548-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ERI1
Alternative Gene Name: 3'HEXO, THEX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031527: 93%, ENSRNOG00000011448: 96%
Entrez Gene ID: 90459
Uniprot ID: Q8IV48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSS |
Gene Sequence | FYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSS |
Gene ID - Mouse | ENSMUSG00000031527 |
Gene ID - Rat | ENSRNOG00000011448 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERI1 pAb (ATL-HPA055548) | |
Datasheet | Anti ERI1 pAb (ATL-HPA055548) Datasheet (External Link) |
Vendor Page | Anti ERI1 pAb (ATL-HPA055548) at Atlas Antibodies |
Documents & Links for Anti ERI1 pAb (ATL-HPA055548) | |
Datasheet | Anti ERI1 pAb (ATL-HPA055548) Datasheet (External Link) |
Vendor Page | Anti ERI1 pAb (ATL-HPA055548) |