Anti ERG pAb (ATL-HPA046598)

Atlas Antibodies

SKU: ATL-HPA046598-25

• 

Protein Description: v-ets avian erythroblastosis virus E26 oncogene homolog
Gene Name: ERG
Alternative Gene Name: erg-3, p55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040732: 96%, ENSRNOG00000001652: 97%
Entrez Gene ID: 2078
Uniprot ID: P11308
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQ
• Gene Sequence: HYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQ
• Gene ID - Mouse: ENSMUSG00000040732
• Gene ID - Rat: ENSRNOG00000001652
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.