Anti ERFE pAb (ATL-HPA077259)

Atlas Antibodies

SKU: ATL-HPA077259-25

• 

Protein Description: erythroferrone
Gene Name: ERFE
Alternative Gene Name: C1QTNF15, CTRP15, FAM132B, FLJ37034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047443: 74%, ENSRNOG00000024688: 79%
Entrez Gene ID: 151176
Uniprot ID: Q4G0M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP
• Gene ID - Mouse: ENSMUSG00000047443
• Gene ID - Rat: ENSMUSG00000047443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.