Protein Description: erythroferrone
Gene Name: ERFE
Alternative Gene Name: C1QTNF15, CTRP15, FAM132B, FLJ37034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047443: 74%, ENSRNOG00000024688: 79%
Entrez Gene ID: 151176
Uniprot ID: Q4G0M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ERFE
Alternative Gene Name: C1QTNF15, CTRP15, FAM132B, FLJ37034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047443: 74%, ENSRNOG00000024688: 79%
Entrez Gene ID: 151176
Uniprot ID: Q4G0M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP |
| Documents & Links for Anti ERFE pAb (ATL-HPA077259) | |
| Datasheet | Anti ERFE pAb (ATL-HPA077259) Datasheet (External Link) |
| Vendor Page | Anti ERFE pAb (ATL-HPA077259) at Atlas |
| Documents & Links for Anti ERFE pAb (ATL-HPA077259) | |
| Datasheet | Anti ERFE pAb (ATL-HPA077259) Datasheet (External Link) |
| Vendor Page | Anti ERFE pAb (ATL-HPA077259) |