Anti ERCC5 pAb (ATL-HPA045845)

Atlas Antibodies

SKU: ATL-HPA045845-25

• 

Protein Description: excision repair cross-complementation group 5
Gene Name: ERCC5
Alternative Gene Name: ERCM2, XPGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026048: 83%, ENSRNOG00000022812: 83%
Entrez Gene ID: 2073
Uniprot ID: P28715
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCE
• Gene Sequence: DDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCE
• Gene ID - Mouse: ENSMUSG00000026048
• Gene ID - Rat: ENSRNOG00000022812
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.