Anti ERCC4 pAb (ATL-HPA045828)

Atlas Antibodies

SKU: ATL-HPA045828-25

• 
• 

Protein Description: excision repair cross-complementation group 4
Gene Name: ERCC4
Alternative Gene Name: FANCQ, RAD1, XPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022545: 75%, ENSRNOG00000053079: 74%
Entrez Gene ID: 2072
Uniprot ID: Q92889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK
• Gene Sequence: SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK
• Gene ID - Mouse: ENSMUSG00000022545
• Gene ID - Rat: ENSRNOG00000053079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.