Anti ERCC2 pAb (ATL-HPA069266)

Atlas Antibodies

SKU: ATL-HPA069266-25

• 

Protein Description: excision repair cross-complementation group 2
Gene Name: ERCC2
Alternative Gene Name: EM9, MAG, MGC102762, MGC126218, MGC126219, TFIIH, XPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030400: 94%, ENSRNOG00000017753: 95%
Entrez Gene ID: 2068
Uniprot ID: P18074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK
• Gene Sequence: QEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK
• Gene ID - Mouse: ENSMUSG00000030400
• Gene ID - Rat: ENSRNOG00000017753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.