Anti ERCC1 pAb (ATL-HPA050182)

Atlas Antibodies

SKU:
ATL-HPA050182-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: excision repair cross-complementation group 1
Gene Name: ERCC1
Alternative Gene Name: RAD10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003549: 87%, ENSRNOG00000017839: 79%
Entrez Gene ID: 2067
Uniprot ID: P07992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMC
Gene Sequence QSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMC
Gene ID - Mouse ENSMUSG00000003549
Gene ID - Rat ENSRNOG00000017839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERCC1 pAb (ATL-HPA050182)
Datasheet Anti ERCC1 pAb (ATL-HPA050182) Datasheet (External Link)
Vendor Page Anti ERCC1 pAb (ATL-HPA050182) at Atlas Antibodies

Documents & Links for Anti ERCC1 pAb (ATL-HPA050182)
Datasheet Anti ERCC1 pAb (ATL-HPA050182) Datasheet (External Link)
Vendor Page Anti ERCC1 pAb (ATL-HPA050182)