Anti ERBIN pAb (ATL-HPA059863 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059863-25

• 
• 

Protein Description: erbb2 interacting protein
Gene Name: ERBIN
Alternative Gene Name: ERBB2IP, LAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021709: 94%, ENSRNOG00000047137: 94%
Entrez Gene ID: 55914
Uniprot ID: Q96RT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPS
• Gene Sequence: SENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPS
• Gene ID - Mouse: ENSMUSG00000021709
• Gene ID - Rat: ENSRNOG00000047137
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.