Anti ERBB3 pAb (ATL-HPA045396)

Atlas Antibodies

Catalog No.:
ATL-HPA045396-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Gene Name: ERBB3
Alternative Gene Name: HER3, LCCS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018166: 78%, ENSRNOG00000004964: 77%
Entrez Gene ID: 2065
Uniprot ID: P21860
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
Gene Sequence LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
Gene ID - Mouse ENSMUSG00000018166
Gene ID - Rat ENSRNOG00000004964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERBB3 pAb (ATL-HPA045396)
Datasheet Anti ERBB3 pAb (ATL-HPA045396) Datasheet (External Link)
Vendor Page Anti ERBB3 pAb (ATL-HPA045396) at Atlas Antibodies

Documents & Links for Anti ERBB3 pAb (ATL-HPA045396)
Datasheet Anti ERBB3 pAb (ATL-HPA045396) Datasheet (External Link)
Vendor Page Anti ERBB3 pAb (ATL-HPA045396)