Anti EPS15 pAb (ATL-HPA008451)

Atlas Antibodies

SKU:
ATL-HPA008451-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: epidermal growth factor receptor pathway substrate 15
Gene Name: EPS15
Alternative Gene Name: AF-1P, MLLT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028552: 81%, ENSRNOG00000010299: 83%
Entrez Gene ID: 2060
Uniprot ID: P42566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Gene Sequence CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Gene ID - Mouse ENSMUSG00000028552
Gene ID - Rat ENSRNOG00000010299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPS15 pAb (ATL-HPA008451)
Datasheet Anti EPS15 pAb (ATL-HPA008451) Datasheet (External Link)
Vendor Page Anti EPS15 pAb (ATL-HPA008451) at Atlas Antibodies

Documents & Links for Anti EPS15 pAb (ATL-HPA008451)
Datasheet Anti EPS15 pAb (ATL-HPA008451) Datasheet (External Link)
Vendor Page Anti EPS15 pAb (ATL-HPA008451)