Anti EPOP pAb (ATL-HPA055190)

Atlas Antibodies

SKU: ATL-HPA055190-25

• 

Protein Description: elongin BC and polycomb repressive complex 2 associated protein
Gene Name: EPOP
Alternative Gene Name: C17orf96, LOC100170841, PRR28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043439: 89%, ENSRNOG00000048187: 92%
Entrez Gene ID: 100170841
Uniprot ID: A6NHQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPL
• Gene Sequence: ETLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPL
• Gene ID - Mouse: ENSMUSG00000043439
• Gene ID - Rat: ENSRNOG00000048187
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.