Anti EPN3 pAb (ATL-HPA055546)

Atlas Antibodies

SKU: ATL-HPA055546-25

• 
• 

Protein Description: epsin 3
Gene Name: EPN3
Alternative Gene Name: FLJ20778, MGC129899
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010080: 83%, ENSRNOG00000003284: 84%
Entrez Gene ID: 55040
Uniprot ID: Q9H201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SADPWDIPGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQPWDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPST
• Gene Sequence: SADPWDIPGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQPWDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPST
• Gene ID - Mouse: ENSMUSG00000010080
• Gene ID - Rat: ENSRNOG00000003284
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EPN3 pAb (ATL-HPA055546) – 1 Found

Mori, Jinichi; Tanikawa, Chizu; Ohnishi, Naomi; Funauchi, Yuki; Toyoshima, Osamu; Ueda, Koji; Matsuda, Koichi. EPSIN 3, A Novel p53 Target, Regulates the Apoptotic Pathway and Gastric Carcinogenesis. Neoplasia (New York, N.y.). 2017;19(3):185-195.