Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054104-25

• 
• 
• 

Protein Description: erythrocyte membrane protein band 4.1-like 1
Gene Name: EPB41L1
Alternative Gene Name: KIAA0338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027624: 88%, ENSRNOG00000057817: 88%
Entrez Gene ID: 2036
Uniprot ID: Q9H4G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE
• Gene Sequence: EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPE
• Gene ID - Mouse: ENSMUSG00000027624
• Gene ID - Rat: ENSRNOG00000057817
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EPB41L1 pAb (ATL-HPA054104 w/enhanced validation) – 1 Found

Liang, Taotao; Sang, Siyao; Shao, Qi; Chen, Chen; Deng, Zhichao; Wang, Ting; Kang, Qiaozhen. Abnormal expression and prognostic significance of EPB41L1 in kidney renal clear cell carcinoma based on data mining. Cancer Cell International. 20( 32760223):356.