Anti EP400 pAb (ATL-HPA049013)

Atlas Antibodies

SKU:
ATL-HPA049013-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: E1A binding protein p400
Gene Name: EP400
Alternative Gene Name: CAGH32, DKFZP434I225, KIAA1498, KIAA1818, P400, TNRC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029505: 91%, ENSRNOG00000037483: 91%
Entrez Gene ID: 57634
Uniprot ID: Q96L91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTIKTSVTGTSMPTGAVSGNVIVNTIAGVPAATFQSINKRLASPVAPGALTTPGGSAPAQVVHTQPPPRAVGSPATATPDLVSMATTQGVRAVTSVTASAVVTTNLTPVQTPARSLVPQVSQAT
Gene Sequence GTIKTSVTGTSMPTGAVSGNVIVNTIAGVPAATFQSINKRLASPVAPGALTTPGGSAPAQVVHTQPPPRAVGSPATATPDLVSMATTQGVRAVTSVTASAVVTTNLTPVQTPARSLVPQVSQAT
Gene ID - Mouse ENSMUSG00000029505
Gene ID - Rat ENSRNOG00000037483
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EP400 pAb (ATL-HPA049013)
Datasheet Anti EP400 pAb (ATL-HPA049013) Datasheet (External Link)
Vendor Page Anti EP400 pAb (ATL-HPA049013) at Atlas Antibodies

Documents & Links for Anti EP400 pAb (ATL-HPA049013)
Datasheet Anti EP400 pAb (ATL-HPA049013) Datasheet (External Link)
Vendor Page Anti EP400 pAb (ATL-HPA049013)