Anti ENTPD6 pAb (ATL-HPA069555)

Atlas Antibodies

SKU:
ATL-HPA069555-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity  in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ectonucleoside triphosphate diphosphohydrolase 6 (putative)
Gene Name: ENTPD6
Alternative Gene Name: CD39L2, dJ738P15.3, IL6ST2, NTPDase-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033068: 83%, ENSRNOG00000007427: 82%
Entrez Gene ID: 955
Uniprot ID: O75354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
Gene Sequence RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
Gene ID - Mouse ENSMUSG00000033068
Gene ID - Rat ENSRNOG00000007427
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ENTPD6 pAb (ATL-HPA069555)
Datasheet Anti ENTPD6 pAb (ATL-HPA069555) Datasheet (External Link)
Vendor Page Anti ENTPD6 pAb (ATL-HPA069555) at Atlas Antibodies

Documents & Links for Anti ENTPD6 pAb (ATL-HPA069555)
Datasheet Anti ENTPD6 pAb (ATL-HPA069555) Datasheet (External Link)
Vendor Page Anti ENTPD6 pAb (ATL-HPA069555)