Protein Description: ectonucleoside triphosphate diphosphohydrolase 6 (putative)
Gene Name: ENTPD6
Alternative Gene Name: CD39L2, dJ738P15.3, IL6ST2, NTPDase-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033068: 83%, ENSRNOG00000007427: 82%
Entrez Gene ID: 955
Uniprot ID: O75354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ENTPD6
Alternative Gene Name: CD39L2, dJ738P15.3, IL6ST2, NTPDase-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033068: 83%, ENSRNOG00000007427: 82%
Entrez Gene ID: 955
Uniprot ID: O75354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD |
| Documents & Links for Anti ENTPD6 pAb (ATL-HPA069555) | |
| Datasheet | Anti ENTPD6 pAb (ATL-HPA069555) Datasheet (External Link) |
| Vendor Page | Anti ENTPD6 pAb (ATL-HPA069555) at Atlas |
| Documents & Links for Anti ENTPD6 pAb (ATL-HPA069555) | |
| Datasheet | Anti ENTPD6 pAb (ATL-HPA069555) Datasheet (External Link) |
| Vendor Page | Anti ENTPD6 pAb (ATL-HPA069555) |