Anti ENOSF1 pAb (ATL-HPA047829 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047829-100

• 
• 

Protein Description: enolase superfamily member 1
Gene Name: ENOSF1
Alternative Gene Name: HSRTSBETA, rTS, TYMSAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025701: 26%, ENSRNOG00000004268: 25%
Entrez Gene ID: 55556
Uniprot ID: Q7L5Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKK
• Gene Sequence: QHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKK
• Gene ID - Mouse: ENSMUSG00000025701
• Gene ID - Rat: ENSRNOG00000004268
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.