Anti ENDOU pAb (ATL-HPA012388 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA012388-25

• 

Protein Description: endonuclease, polyU-specific
Gene Name: ENDOU
Alternative Gene Name: P11, PP11, PRSS26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022468: 86%, ENSRNOG00000056446: 83%
Entrez Gene ID: 8909
Uniprot ID: P21128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY
• Gene Sequence: CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY
• Gene ID - Mouse: ENSMUSG00000022468
• Gene ID - Rat: ENSRNOG00000056446
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ENDOU pAb (ATL-HPA012388 w/enhanced validation) – 2 Found

Basic, Vladimir; Zhang, Boxi; Domert, Jakob; Pellas, Ulrika; Tot, Tibor. Integrative meta-analysis of gene expression profiles identifies FEN1 and ENDOU as potential diagnostic biomarkers for cervical squamous cell carcinoma. Oncology Letters. 2021;22(6):840. 

Deng, Pengwei; Cui, Kangli; Shi, Yang; Zhu, Yujuan; Wang, Yaqing; Shao, Xiaoguang; Qin, Jianhua. Fluidic Flow Enhances the Differentiation of Placental Trophoblast-Like 3D Tissue from hiPSCs in a Perfused Macrofluidic Device. Frontiers In Bioengineering And Biotechnology. 10( 35845423):907104.