Anti EME2 pAb (ATL-HPA045770)

Atlas Antibodies

SKU:
ATL-HPA045770-25
  • Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: essential meiotic structure-specific endonuclease subunit 2
Gene Name: EME2
Alternative Gene Name: FLJ00151, SLX2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073436: 69%, ENSRNOG00000024867: 69%
Entrez Gene ID: 197342
Uniprot ID: A4GXA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS
Gene Sequence ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS
Gene ID - Mouse ENSMUSG00000073436
Gene ID - Rat ENSRNOG00000024867
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EME2 pAb (ATL-HPA045770)
Datasheet Anti EME2 pAb (ATL-HPA045770) Datasheet (External Link)
Vendor Page Anti EME2 pAb (ATL-HPA045770) at Atlas Antibodies

Documents & Links for Anti EME2 pAb (ATL-HPA045770)
Datasheet Anti EME2 pAb (ATL-HPA045770) Datasheet (External Link)
Vendor Page Anti EME2 pAb (ATL-HPA045770)