Anti EMC8 pAb (ATL-HPA049476)

Atlas Antibodies

SKU: ATL-HPA049476-25

• 
• 

Protein Description: ER membrane protein complex subunit 8
Gene Name: EMC8
Alternative Gene Name: C16orf2, C16orf4, COX4NB, FAM158B, NOC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031819: 83%, ENSRNOG00000017654: 83%
Entrez Gene ID: 10328
Uniprot ID: O43402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD
• Gene Sequence: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD
• Gene ID - Mouse: ENSMUSG00000031819
• Gene ID - Rat: ENSRNOG00000017654
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.