Anti EMC10 pAb (ATL-HPA053905)

Atlas Antibodies

SKU: ATL-HPA053905-25

• 
• 

Protein Description: ER membrane protein complex subunit 10
Gene Name: EMC10
Alternative Gene Name: C19orf63, HSM1, HSS1, INM02
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008140: 90%, ENSRNOG00000019532: 89%
Entrez Gene ID: 284361
Uniprot ID: Q5UCC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN
• Gene Sequence: DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN
• Gene ID - Mouse: ENSMUSG00000008140
• Gene ID - Rat: ENSRNOG00000019532
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.