Anti EMC1 pAb (ATL-HPA048904)

Atlas Antibodies

SKU: ATL-HPA048904-25

• 
• 

Protein Description: ER membrane protein complex subunit 1
Gene Name: EMC1
Alternative Gene Name: KIAA0090
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078517: 93%, ENSRNOG00000018097: 93%
Entrez Gene ID: 23065
Uniprot ID: Q8N766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTL
• Gene Sequence: LKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTL
• Gene ID - Mouse: ENSMUSG00000078517
• Gene ID - Rat: ENSRNOG00000018097
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.