Anti ELSPBP1 pAb (ATL-HPA050341 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050341-25

• 

Protein Description: epididymal sperm binding protein 1
Gene Name: ELSPBP1
Alternative Gene Name: E12, EDDM12, HE12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031740: 43%, ENSRNOG00000016695: 43%
Entrez Gene ID: 64100
Uniprot ID: Q96BH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
• Gene Sequence: TTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
• Gene ID - Mouse: ENSMUSG00000031740
• Gene ID - Rat: ENSRNOG00000016695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.