Anti ELP6 pAb (ATL-HPA046358)

Atlas Antibodies

SKU: ATL-HPA046358-25

• 
• 

Protein Description: elongator acetyltransferase complex subunit 6
Gene Name: ELP6
Alternative Gene Name: C3orf75, FLJ20211, TMEM103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054836: 76%, ENSRNOG00000020847: 76%
Entrez Gene ID: 54859
Uniprot ID: Q0PNE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
• Gene Sequence: VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
• Gene ID - Mouse: ENSMUSG00000054836
• Gene ID - Rat: ENSRNOG00000020847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.