Anti ELP5 pAb (ATL-HPA052411)

Atlas Antibodies

SKU: ATL-HPA052411-25

• 
• 

Protein Description: elongator acetyltransferase complex subunit 5
Gene Name: ELP5
Alternative Gene Name: C17orf81, DERP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018565: 69%, ENSRNOG00000027628: 61%
Entrez Gene ID: 23587
Uniprot ID: Q8TE02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCTTLCQVLHAVSHQDSCPGDSSSVGKVSVLG
• Gene Sequence: FFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCTTLCQVLHAVSHQDSCPGDSSSVGKVSVLG
• Gene ID - Mouse: ENSMUSG00000018565
• Gene ID - Rat: ENSRNOG00000027628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.