Anti ELF4 pAb (ATL-HPA060277)

Atlas Antibodies

SKU: ATL-HPA060277-25

• 

Protein Description: E74-like factor 4 (ets domain transcription factor)
Gene Name: ELF4
Alternative Gene Name: ELFR, MEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031103: 52%, ENSRNOG00000005352: 53%
Entrez Gene ID: 2000
Uniprot ID: Q99607
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKT
• Gene Sequence: TDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKT
• Gene ID - Mouse: ENSMUSG00000031103
• Gene ID - Rat: ENSRNOG00000005352
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.