Protein Description: elaC ribonuclease Z 1
Gene Name: ELAC1
Alternative Gene Name: D29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036941: 85%, ENSRNOG00000000113: 84%
Entrez Gene ID: 55520
Uniprot ID: Q9H777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ELAC1
Alternative Gene Name: D29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036941: 85%, ENSRNOG00000000113: 84%
Entrez Gene ID: 55520
Uniprot ID: Q9H777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGF |
| Documents & Links for Anti ELAC1 pAb (ATL-HPA066483) | |
| Datasheet | Anti ELAC1 pAb (ATL-HPA066483) Datasheet (External Link) |
| Vendor Page | Anti ELAC1 pAb (ATL-HPA066483) at Atlas |
| Documents & Links for Anti ELAC1 pAb (ATL-HPA066483) | |
| Datasheet | Anti ELAC1 pAb (ATL-HPA066483) Datasheet (External Link) |
| Vendor Page | Anti ELAC1 pAb (ATL-HPA066483) |