Anti EIF4E3 pAb (ATL-HPA058649)

Atlas Antibodies

SKU: ATL-HPA058649-25

• 

Protein Description: eukaryotic translation initiation factor 4E family member 3
Gene Name: EIF4E3
Alternative Gene Name: MGC39820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093661: 96%, ENSRNOG00000010301: 96%
Entrez Gene ID: 317649
Uniprot ID: Q8N5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY
• Gene Sequence: LLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIY
• Gene ID - Mouse: ENSMUSG00000093661
• Gene ID - Rat: ENSRNOG00000010301
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.